Add folder with Python mailing list messages

Cargo.lock

@@ -1015,11 +1015,12 @@ checksum = "2a60c7ce501c71e03a9c9c0d35b861413ae925bd979cc7a4e30d060069aaac8d"
 
 [[package]]
 name = "miniz_oxide"
-version = "0.4.1"
+version = "0.4.2"
 source = "registry+https://github.com/rust-lang/crates.io-index"
-checksum = "4d7559a8a40d0f97e1edea3220f698f78b1c5ab67532e49f68fde3910323b722"
+checksum = "c60c0dfe32c10b43a144bad8fc83538c52f58302c92300ea7ec7bf7b38d5a7b9"
 dependencies = [
  "adler",
+ "autocfg",
 ]
 
 [[package]]

demo/ermis-f/python_m/cur/0001

@@ -0,0 +1,79 @@
+From: jepler at inetnebr.com (Jeff Epler)
+Date: 21 Feb 1999 18:21:29 GMT
+Subject: New (?) suggestion to solve "assignment-in-while" desire
+Message-ID: <mailman.0.1433094741.31156.python-list@python.org>
+X-IMAPbase: 1567524838 0000742335
+X-UID: 1                                                  
+Content-Length: 2202
+
+We all know what the problem looks like:
+
+        while 1:
+                x=sys.stdin.readline()
+                if not x: break
+                ....
+
+well, someone can write an "xreadlines" which permits
+        for i in xreadlines(sys.stdin):
+                ....
+
+but next, who knows what "x"-function we will need.
+
+And, at the same time, "for" embodies a test (for IndexError) and an
+assignment (to the loop variable).  So what we need is a nice, generic
+class to embody this sort of functionality, with the ability to use an
+arbitrary test on the assigned value, as well as accept an arbitrary
+exception as an "end of loop" marker.
+
+This is an implementation of the "lazy" class, which does what I've
+discussed:
+
+--------------------------------------------------------------------------
+class lazy:
+        def __init__(self, function, test=lambda x: not x, exception=None,
+                        index=0):
+                self.f=function
+                self.t=test
+                self.e=exception
+                self.i=index
+
+        def __getitem__(self, i):
+                try:
+                        if self.i: ret=self.f(i)
+                        else: ret=self.f()
+                except self.e:
+                        raise IndexError
+                if self.t(ret):
+                        raise IndexError
+                return ret
+--------------------------------------------------------------------------
+here are some uses of it:  xreadlines, and "xrange1" a limited
+reimplementation of xrange.
+
+--------------------------------------------------------------------------
+xreadlines=lambda x: lazy(x.readline, exception=EOFError)
+xrange1=lambda min, max, inc: lazy(lambda x, min=min, inc=inc: min+inc*x,
+        lambda y, max=max: y>=max, index=1)
+--------------------------------------------------------------------------
+
+the basic
+        for i in lazy(f):
+                body
+is the same as:
+        while 1:
+                i=f()
+                if not i: break
+                body
+
+but you can embellish with more complicated tests, exception tests, or
+whatever.
+
+The class assumes it will be called in a "for-like way" so please refrain
+from taunting it.
+
+Jeff
+
+
+
+
+

demo/ermis-f/python_m/cur/0002

@@ -0,0 +1,77 @@
+From: jepler at inetnebr.com (Jeff Epler)
+Date: 21 Feb 1999 18:21:29 GMT
+Subject: New (?) suggestion to solve "assignment-in-while" desire
+Message-ID: <mailman.3.1433095024.31156.python-list@python.org>
+X-UID: 2                                                  
+Content-Length: 2201
+
+We all know what the problem looks like:
+
+        while 1:
+                x=sys.stdin.readline()
+                if not x: break
+                ....
+
+well, someone can write an "xreadlines" which permits
+        for i in xreadlines(sys.stdin):
+                ....
+
+but next, who knows what "x"-function we will need.
+
+And, at the same time, "for" embodies a test (for IndexError) and an
+assignment (to the loop variable).  So what we need is a nice, generic
+class to embody this sort of functionality, with the ability to use an
+arbitrary test on the assigned value, as well as accept an arbitrary
+exception as an "end of loop" marker.
+
+This is an implementation of the "lazy" class, which does what I've
+discussed:
+
+--------------------------------------------------------------------------
+class lazy:
+        def __init__(self, function, test=lambda x: not x, exception=None,
+                        index=0):
+                self.f=function
+                self.t=test
+                self.e=exception
+                self.i=index
+
+        def __getitem__(self, i):
+                try:
+                        if self.i: ret=self.f(i)
+                        else: ret=self.f()
+                except self.e:
+                        raise IndexError
+                if self.t(ret):
+                        raise IndexError
+                return ret
+--------------------------------------------------------------------------
+here are some uses of it:  xreadlines, and "xrange1" a limited
+reimplementation of xrange.
+
+--------------------------------------------------------------------------
+xreadlines=lambda x: lazy(x.readline, exception=EOFError)
+xrange1=lambda min, max, inc: lazy(lambda x, min=min, inc=inc: min+inc*x,
+        lambda y, max=max: y>=max, index=1)
+--------------------------------------------------------------------------
+
+the basic
+        for i in lazy(f):
+                body
+is the same as:
+        while 1:
+                i=f()
+                if not i: break
+                body
+
+but you can embellish with more complicated tests, exception tests, or
+whatever.
+
+The class assumes it will be called in a "for-like way" so please refrain
+from taunting it.
+
+Jeff
+
+
+
+

demo/ermis-f/python_m/cur/0003

@@ -0,0 +1,34 @@
+From: wavers at mail.pt (waver)
+Date: Sat, 27 Mar 1999 15:25:30 +0000
+Subject: help-me please
+Message-ID: <000801be7866$0d4d0020$6d0f1ed5@wavers>
+Content-Length: 1106
+X-UID: 3                                                                                    
+
+Hi!
+i am a portuguese guy that heve some questions about Python.
+I read some tuturials but all only talk about how to program with Python
+ and
+that is very important) but i want to know some other things:
+1-What do we do with Python?
+2-Can Python do some programs ?
+3-Python is a language only to Internet or can do some programs ?
+4-Explain how do i write my things in Python , i know that in the Python
+Shell we can write some commands but if i want to build some thing in Python
+i write in notepad and then how do i test it ??
+5-Does any Web Hosting Server support Python?
+
+I know that are some lhamme questions but i want to learn Python so first i
+nedd to know how does Python word and what does it do.
+So please try to answear my questions , and for that email-me wavers at mail.pt
+because i don`t know how to work with newsgroup.
+Thank very much AND PELASE ANSWER MY QUESTION WITH ANY EMAIL TO
+WAVERS at MAIL.PT .
+
+Byeeeeee
+
+-------------- next part --------------
+An HTML attachment was scrubbed...
+URL: <http://mail.python.org/pipermail/python-list/attachments/19990327/b369b473/attachment.html>
+
+

demo/ermis-f/python_m/cur/0004

@@ -0,0 +1,35 @@
+From: python at rose164.wuh.wustl.edu (David Fisher)
+Date: Sat, 20 Mar 1999 19:48:27 -0600
+Subject: Simple tuple question
+Message-ID: <021001be7343$35563dc0$8f3dfc80@spkydomain>
+Content-Length: 1251
+X-UID: 4                                                  
+
+Spam detection software, running on the system "albatross.python.org", has
+identified this incoming email as possible spam.  The original message
+has been attached to this so you can view it (if it isn't spam) or label
+similar future email.  If you have any questions, see
+the administrator of that system for details.
+
+Content preview:  ----- Original Message ----- From: "Jeff Shipman" <shippy at cs.nmt.edu>
+   Newsgroups: comp.lang.python To: <python-list at python.org> Sent: Monday, March
+   20, 2000 11:54 AM Subject: Re: Simple tuple question [...] 
+
+Content analysis details:   (5.7 points, 5.0 required)
+
+ pts rule name              description
+---- ---------------------- --------------------------------------------------
+ 2.0 FH_DATE_IS_19XX        The date is not 19xx.
+ 1.4 NO_DNS_FOR_FROM        DNS: Envelope sender has no MX or A DNS records
+ 2.3 DATE_IN_PAST_96_XX     Date: is 96 hours or more before Received: date
+
+
+-------------- next part --------------
+An embedded message was scrubbed...
+From: "David Fisher" <python at rose164.wuh.wustl.edu>
+Subject: Re: Simple tuple question
+Date: Sat, 20 Mar 1999 19:48:27 -0600
+Size: 1894
+URL: <http://mail.python.org/pipermail/python-list/attachments/19990320/1ce203c0/attachment.mht>
+
+

demo/ermis-f/python_m/cur/0005

@@ -0,0 +1,36 @@
+From: python at rose164.wuh.wustl.edu (David Fisher)
+Date: Sun, 21 Mar 1999 11:37:38 -0600
+Subject: making py modules with C
+Message-ID: <012701be73c1$a2872200$573dfc80@spkydomain>
+Content-Length: 1284
+X-UID: 5                                                  
+
+Spam detection software, running on the system "albatross.python.org", has
+identified this incoming email as possible spam.  The original message
+has been attached to this so you can view it (if it isn't spam) or label
+similar future email.  If you have any questions, see
+the administrator of that system for details.
+
+Content preview:  ----- Original Message ----- From: "Gordon McMillan" <gmcm at hypernet.com>
+   To: "David Fisher" <python at rose164.wuh.wustl.edu>; <python-list at python.org>
+   Sent: Tuesday, March 21, 2000 6:49 AM Subject: Re: making py modules with
+   C [...] 
+
+Content analysis details:   (5.7 points, 5.0 required)
+
+ pts rule name              description
+---- ---------------------- --------------------------------------------------
+ 1.4 NO_DNS_FOR_FROM        DNS: Envelope sender has no MX or A DNS records
+ 2.0 FH_DATE_IS_19XX        The date is not 19xx.
+ 2.3 DATE_IN_PAST_96_XX     Date: is 96 hours or more before Received: date
+
+
+-------------- next part --------------
+An embedded message was scrubbed...
+From: "David Fisher" <python at rose164.wuh.wustl.edu>
+Subject: Re: making py modules with C
+Date: Sun, 21 Mar 1999 11:37:38 -0600
+Size: 2969
+URL: <http://mail.python.org/pipermail/python-list/attachments/19990321/3f73cd3d/attachment.mht>
+
+

demo/ermis-f/python_m/cur/0006

@@ -0,0 +1,36 @@
+From: python at rose164.wuh.wustl.edu (David Fisher)
+Date: Sat, 20 Mar 1999 20:32:35 -0600
+Subject: making py modules with C
+Message-ID: <021101be7343$36381240$8f3dfc80@spkydomain>
+Content-Length: 1294
+X-UID: 6                                                  
+
+Spam detection software, running on the system "albatross.python.org", has
+identified this incoming email as possible spam.  The original message
+has been attached to this so you can view it (if it isn't spam) or label
+similar future email.  If you have any questions, see
+the administrator of that system for details.
+
+Content preview:  I don't know about the make but I can point out a few syntax
+   errors. ----- Original Message ----- From: "Shaun Hogan" <shogan at iel.ie>
+  To: "python" <python-list at cwi.nl> Sent: Monday, March 20, 2000 4:56 AM Subject:
+   making py modules with C [...] 
+
+Content analysis details:   (5.7 points, 5.0 required)
+
+ pts rule name              description
+---- ---------------------- --------------------------------------------------
+ 1.4 NO_DNS_FOR_FROM        DNS: Envelope sender has no MX or A DNS records
+ 2.0 FH_DATE_IS_19XX        The date is not 19xx.
+ 2.3 DATE_IN_PAST_96_XX     Date: is 96 hours or more before Received: date
+
+
+-------------- next part --------------
+An embedded message was scrubbed...
+From: "David Fisher" <python at rose164.wuh.wustl.edu>
+Subject: Re: making py modules with C
+Date: Sat, 20 Mar 1999 20:32:35 -0600
+Size: 3327
+URL: <http://mail.python.org/pipermail/python-list/attachments/19990320/fbf53fd2/attachment.mht>
+
+

demo/ermis-f/python_m/cur/0007

@@ -0,0 +1,37 @@
+From: python at rose164.wuh.wustl.edu (David Fisher)
+Date: Sun, 21 Mar 1999 10:37:41 -0600
+Subject: Importing "Modules"
+Message-ID: <007d01be73b9$38fb7460$573dfc80@spkydomain>
+Content-Length: 1353
+X-UID: 7                                                  
+
+Spam detection software, running on the system "albatross.python.org", has
+identified this incoming email as possible spam.  The original message
+has been attached to this so you can view it (if it isn't spam) or label
+similar future email.  If you have any questions, see
+the administrator of that system for details.
+
+Content preview:  ----- Original Message ----- From: "Adrian Eyre" <a.eyre at optichrome.com>
+   To: "JJ" <joacim at home.se>; <python-list at python.org> Sent: Tuesday, March
+  21, 2000 5:45 AM Subject: RE: Importing "Modules" > > Constants.pyc > > [snip]
+   > > Call this file "Constants.py". The .pyc will be generated for you. >
+  [...] 
+
+Content analysis details:   (5.7 points, 5.0 required)
+
+ pts rule name              description
+---- ---------------------- --------------------------------------------------
+ 1.4 NO_DNS_FOR_FROM        DNS: Envelope sender has no MX or A DNS records
+ 2.0 FH_DATE_IS_19XX        The date is not 19xx.
+ 2.3 DATE_IN_PAST_96_XX     Date: is 96 hours or more before Received: date
+
+
+-------------- next part --------------
+An embedded message was scrubbed...
+From: "David Fisher" <python at rose164.wuh.wustl.edu>
+Subject: Re: Importing "Modules"
+Date: Sun, 21 Mar 1999 10:37:41 -0600
+Size: 3255
+URL: <http://mail.python.org/pipermail/python-list/attachments/19990321/d1654221/attachment.mht>
+
+

demo/ermis-f/python_m/cur/0008

@@ -0,0 +1,37 @@
+From: python at rose164.wuh.wustl.edu (David Fisher)
+Date: Wed, 17 Mar 1999 09:31:02 -0600
+Subject: Code basics
+Message-ID: <011901be708b$41ebf3a0$3f3dfc80@spkydomain>
+Content-Length: 1432
+X-UID: 8                                                  
+
+Spam detection software, running on the system "albatross.python.org", has
+identified this incoming email as possible spam.  The original message
+has been attached to this so you can view it (if it isn't spam) or label
+similar future email.  If you have any questions, see
+the administrator of that system for details.
+
+Content preview:  Hi JJ, You indicate a block with indentation. Like so: while
+   notDone: chip = self.getNumberOfSomething() if chip == 10: print "Tjohoo"
+   else: print "Oh no!" I changed the this to self because thats the usual way
+   of calling an instance method. Just pretend there's a class floating just
+   off screen that this is inside of. [...] 
+
+Content analysis details:   (5.3 points, 5.0 required)
+
+ pts rule name              description
+---- ---------------------- --------------------------------------------------
+ 1.4 NO_DNS_FOR_FROM        DNS: Envelope sender has no MX or A DNS records
+ 2.0 FH_DATE_IS_19XX        The date is not 19xx.
+ 2.3 DATE_IN_PAST_96_XX     Date: is 96 hours or more before Received: date
+-0.4 AWL                    AWL: From: address is in the auto white-list
+
+
+-------------- next part --------------
+An embedded message was scrubbed...
+From: "David Fisher" <python at rose164.wuh.wustl.edu>
+Subject: Re: Code basics
+Date: Wed, 17 Mar 1999 09:31:02 -0600
+Size: 2336
+URL: <http://mail.python.org/pipermail/python-list/attachments/19990317/a65f1127/attachment.mht>
+

demo/ermis-f/python_m/cur/0009

@@ -0,0 +1,29 @@
+From: mail at to.me (Usenet User)
+Date: 28 Apr 1999 05:53:36 GMT
+Subject: GUI other than Tkinter (TVision?)
+References: <3721567f.1748033@news> <7g1a8h$fae$1@Starbase.NeoSoft.COM>
+Message-ID: <8DB68CFE2HolyMama@bbinews.netvigator.com>
+X-UID: 9                                                                                    
+
+Anyone interested in wrap this TVision with python?
+http://www.geocities.com/SiliconValley/Vista/6552/tvision.html
+
+Turbo Vision is the good old TUI (Text User Interface) we
+used in Turbo C++ and it is GPLed. It is written in C++ and maybe someone
+want to wrap it with python.
+
+========== 
+What's Turbo Vision?
+
+Turbo Vision (TVision for short) is a TUI (Text User Interface) that
+implements the well known CUA widgets. With TVision you can create an
+intuitive text mode application, intuitive means it will have CUA like
+interface (check boxes, radio buttons, push buttons, input lines, pull
+-down menues, status bars, etc.). All the people acustomed to the 
+Windows, MacOS, OS/2, Motif, GTK, etc. interfaces will understand the
+interface at first sight.
+===========
+
+
+
+

demo/ermis-f/python_m/cur/0010

@@ -0,0 +1,51 @@
+From: mcannon at 21stcentury.net (Michael J. Cannon)
+Date: Mon, 12 Apr 1999 23:40:19 -0500
+Subject: Python and Nutcracker
+References: <370B62F2.93D76301@oi42.kwu.siemens.de>
+Message-ID: <3712CAB2.77A5AF2B@21stcentury.net>
+Content-Length: 1650
+X-UID: 10                                                 
+
+Dr Tschammer:
+
+Speaking from experience, both in supporting (independently of
+DataFocus) and porting, all I can say is be careful of the I/O and
+exception handling in the Nutcracker, especially when addressing issues
+involved in Winsock and calls to any messaging .dll's or libraries.
+Also, your users will have to disable the Nutcracker service manually
+when doing backups from NT databases on the server (especially SQL
+server and Oracle) and then manually restart, as cron and at -type calls
+are problematic with the Nutcracker services running.  Finally, license
+WinBatch for your customers/users as they will need it.
+
+Personally, I have given up on Nutcracker as support is both expensive
+and a nightmare of frustrated users.  My preferred platform is now Java
+(via javat) or a mix of c (GNU C or C+/++) and python.
+
+For a taste of what you're in for as far as support, check out the EDI-L
+mailing list and watch for messages on Harbinger's TLE product (formerly
+UNIX PREMENOS), or see if you can't get in contact with someone who will
+honestly critique NUWC's efforts (prominently featured on the DataFocus
+site).
+
+My feeling is that Nutcracker was a good idea with a rushed
+implementation.  With all the faults of NT, to depend on a set of
+libraries existing as a service, poorly implemented, is asking for
+trouble.
+
+"Dr. Armin Tschammer" wrote:
+
+> Hi,
+> Has anyone experience with Python and Nutcracker ?
+> We are using embedded Python in our application which
+> is developed under HPUX.
+> We are now porting our application to Windows NT
+> with the help of the Nutcracker library.
+> Has anyone already done such stuff ?
+>
+>       Armin
+
+
+
+
+

demo/ermis-f/python_m/cur/0011

@@ -0,0 +1,108 @@
+From: faassen at pop.vet.uu.nl (Martijn Faassen)
+Date: Thu, 22 Apr 1999 19:49:24 +0200
+Subject: Pointers to variables
+References: <19990422121403.A279051@vislab.epa.gov>
+Message-ID: <371F6124.48EA9794@pop.vet.uu.nl>
+Content-Length: 3214
+X-UID: 11                                                 
+
+Randall Hopper wrote:
+> 
+> This doesn't work:
+> 
+>     for ( var, str ) in [( self.min, 'min_units' ),
+>                          ( self.max, 'max_units' )]:
+>       if cnf.has_key( str ):
+>         var = cnf[ str ]
+>         del cnf[ str ]
+> 
+> It doesn't assign values to self.min, self.max (both integers).  The values
+> of these variables are inserted into the tuples and not references to the
+> variables themselves, which is the problem.
+> 
+> How can I cause a reference to the variables to be stored in the tuples
+> instead of their values?
+
+Hi there, 
+
+I've been trying to understand the purpose of the code in your fragment
+and your question for a minute or so, but I'm not entirely sure I get it
+yet.
+
+I'm assuming what you want is to get 'cnf[str]' assigned to self.min or
+self.max.
+
+What you could do is something like this:
+
+    for str in ('min_units', 'max_units'):
+        if cnf.has_key(str):
+            setattr(self, str, cnf[str])
+            del cnf[str]
+
+Tuples, by the way are immutable, so you can't change what values their
+elements point to after they've been created (though if these values
+point to other things themselves you can change that). That is, you
+can't do this:
+
+    foo = (value1, value2)
+    foo[0] = "hey"
+
+But, if you'd use a mutable list, you still run into trouble. If you say
+this:
+
+    mylist = [None]                         # list with a single element
+None
+    variable_i_want_to_change = "Foo"       # a variable I want to
+change
+    mylist[0] = variable_i_want_to_change   # okay, mylist[0] points to
+same data
+    mylist[0] = "Bar"                       # now mylist[0] points to
+different data
+
+then 'variable_i_want_to_change' won't change. You've simply changed
+what value mylist[0] points at. This is because a string (and integers
+etc) are immutable values in Python. If you use a mutable value such as
+a dictionary, you get this:
+
+    mylist = [None]
+    variable_i_want_to_change = {}
+    mylist[0] = variable_i_want_to_change
+    mylist[0]["some key"] = "bar" # indeed changes
+variable_i_want_to_change!
+    # mylist[0] = "Bar" -- doesn't work, makes mylist[0] point elsewhere
+
+I suspect I'm making things sound horribly complicated when they aren't
+really. I can keep all this in my head easily, it's just hard
+communicating it. I can understand the confusion with pointers from C,
+but note that this is the actual semi-equivalent C code (of the first
+fragment, not the dict one, and using ints instead of strings):
+
+/* Initialize the variables, assume easy allocate functions which do all
+the 
+   malloc() calls I don't want to figure out right now */
+int** mylist = allocate_list();
+*mylist[0] = 0;  
+/* now we have a list with a pointer to an int value, which is 0 */
+
+int* variable_i_want_to_change = allocate_int();
+*variable_i_want_to_change = 1;
+/* now we have a variable which points to an int value, which is 1 */
+
+*mylist[0] = *variable_i_want_to_change;
+/* now the data mylist[0] points at becomes 1 too */
+
+*mylist[0] = 2;
+/* now the data mylist[0] points at becomes 2 */
+
+/* has the data *variable_i_want_to_change changed? no. I hope! :)*/
+ 
+I don't expect this explained a lot. I feel like Tim Peters somehow...
+:)
+
+Regards,
+
+Martijn
+
+
+
+

demo/ermis-f/python_m/cur/0012

@@ -0,0 +1,14 @@
+From: tville at earthlink.net (susan e paolini)
+Date: Wed, 14 Apr 1999 13:01:30 -0400
+Subject: what do you do with Python
+Message-ID: <3714C9EA.86C0A4E@earthlink.net>
+X-UID: 12                                                 
+
+I never see jobs with Python advertised so what is it that Python does?
+Thanks for the advice
+
+
+
+
+
+

demo/ermis-f/python_m/cur/0013

@@ -0,0 +1,20 @@
+From: roy at popmail.med.nyu.edu (Roy Smith)
+Date: Thu, 29 Apr 1999 14:02:40 -0400
+Subject: padding strings
+Message-ID: <roy-2904991402400001@qwerky.med.nyu.edu>
+X-UID: 13                                                 
+
+Given a string, I want to generate another string which is exactly N
+characters long.  If the first string is less than N, I want to blank-pad
+it.  If the first string is greater than N, I want to truncate it.
+
+What's the most straight-forward way to do that?
+
+-- 
+Roy Smith <roy at popmail.med.nyu.edu>
+New York University School of Medicine
+
+
+
+
+

demo/ermis-f/python_m/cur/0014

@@ -0,0 +1,23 @@
+From: larsga at ifi.uio.no (Lars Marius Garshol)
+Date: 06 Apr 1999 07:33:09 +0200
+Subject: SNMPy update
+References: <7e1hiq$a71$1@Starbase.NeoSoft.COM> 	<7ear25$ksf$1@news-sj-3.cisco.com> <14089.11820.416453.80124@bitdiddle.cnri.reston.va.us>
+Message-ID: <wkiubacnze.fsf@ifi.uio.no>
+X-UID: 14                                                 
+
+* Jeremy Hylton
+|
+| expect that I'd want to release it given the export control hassles.
+| However, it seemed clear to me that an ASN.1 compiler could be
+| written to generate the encode/decode routines.  If someone is
+| interested in that, I've got some design notes and rough code on how
+| to do the encode/decode and on how to build a backend for SNACC.
+
+I'd be interested in that. I've been thinking of doing a pure-Python
+LDAP client.
+
+--Lars M.
+
+
+
+

demo/ermis-f/python_m/cur/0015

@@ -0,0 +1,105 @@
+From: sweeting at neuronet.com.my (sweeting at neuronet.com.my)
+Date: Sun, 25 Apr 1999 20:11:31 GMT
+Subject: converting perl to python - simple questions.
+References: <000001be8f3e$eea9c3c0$d39e2299@tim>
+Message-ID: <7fvstg$nqo$1@nnrp1.dejanews.com>
+Content-Length: 3248
+X-UID: 15                                                 
+
+
+> > Anyway, since I know that there are a few ex-perlmongers on the list,
+> > would somebody be so kind as to confirm whether I've translated
+> > the following code snippets correctly :
+> >
+> > a) Perl's "defined".
+> >    [perl]
+> >    if (defined($x{$token})
+> >
+> >    [python]
+> >    if (x.has_key(token) and x[token]!=None) :
+>
+> If should be enough to do
+>
+>     if x.has_key(token):
+>
+> under the probably-correct theory that the Perl is just asking "does hash
+> 'x' have key 'token'?"  "None" is a specific valid value, not at all
+> "undefined", so checking x[token] against None doesn't make sense unless
+> you've established your own consistent program-wide convention of using None
+> to *mean* something like undefined.  Which is dicey.  After e.g. "del
+> x[token]", a reference to x[token] doesn't yield None, it raises the
+> KeyError exception.
+
+For years, I've been thinking of "None" in Python as "null" in javascript,
+meaning "no value set" and so it was actually quite interesting to see that
+Perl has "exists" and "defined"  functions for dictionaries.... I had
+translated "exists($dictionary{$token})" into  "dictionary.has_key(token)"
+and  hence went overboard when I translated "defined(...)"
+
+Anyway, from testing it does appear that both defined() and exists()
+can be simply replaced with dico.has_key(token) in my scripts.
+
+
+> > b) RE's.
+> >    [perl]
+> >    if ($mytext !~ /^\s$/)
+> >
+> >    [python]
+> >    if not (re.match('^\s$'), mytext)
+>
+> Hmm.  The Perl says "if mytext isn't a single whitespace character", which
+> is an odd thing to check!  If that's the intent, fine.
+
+Yes, loads of double-byte character processing ...
+
+> Python's "match"
+> already constrains the search to begin at the start of the string, so the
+> leading "^" isn't needed (use Python's "search" if don't want that
+> constraint).
+
+aaaah - subtle. Thanks.
+
+>So:
+>
+>     if not re.match(r"\s$", mytext):
+>
+> Get in the habit of using r-strings for writing regexps; they'll make your
+> backslash life much easier.
+
+Thank you for pointing that out - the perl stuff's been screwing
+with my head and making me confused, \s being ok in that language.
+
+> Another thing to note is that high-use regexps can be compiled, and if
+> they're always used in the same way (match vs search) you can capture that
+> choice too.  So this may be more appropriate:
+>
+> is_single_whitespace = re.compile(r"\s$").match
+>
+> while whatever:
+>     ...
+>     if not is_single_whitespace(mytext):
+>         ...
+>     ...
+
+Thank you very much - I'd read the excellent howto on python.org and that
+described this too. I chose not to compile just for clarity since I'm still
+trying to work out if I've translated the code from perl to python
+correctly. But I will optimise later...
+
+> Hoisting the regexp compilation out of the loop can be a substantial win.
+>
+> > Since I know neither perl nor chinese, it would be nice if somebody
+> > could help me remove one of the variables in my debugging.
+>
+> native-speakers-of-both-say-chinese-is-easier-to-read<wink>-ly y'rs  - tim
+
+after today, i'd be inclined to agree :)
+
+chas
+
+-----------== Posted via Deja News, The Discussion Network ==----------
+http://www.dejanews.com/       Search, Read, Discuss, or Start Your Own    
+
+
+
+

demo/ermis-f/python_m/cur/0016

@@ -0,0 +1,110 @@
+From: parkw at better.net (William Park)
+Date: Wed, 28 Apr 1999 15:20:42 -0400
+Subject: HTML "sanitizer" in Python
+In-Reply-To: <s72703fc.021@holnam.com>; from Scott Stirling on Wed, Apr 28, 1999 at 12:49:55PM -0400
+References: <s72703fc.021@holnam.com>
+Message-ID: <19990428152042.A708@better.net>
+Content-Length: 4007
+X-UID: 16                                                 
+
+On Wed, Apr 28, 1999 at 12:49:55PM -0400, Scott Stirling wrote:
+> Hi,
+> 
+> I am new to Python.  I have an idea of a work-related project I want
+> to do, and I was hoping some folks on this list might be able to
+> help me realize it.  I have Mark Lutz' _Programming Python_ book,
+> and that has been a helpful orientation.  I like his basic packer
+> and unpacker scripts, but what I want to do is something in between
+> that basic program and its later, more complex manifestations.
+> 
+> I am on a Y2K project with 14 manufacturing plants, each of which
+> has an inventory of  plant process components that need to be tested
+> and/or replaced.  I want to put each plant's current inventory on
+> the corporate intranet on a weekly or biweekly basis.  All the plant
+> data is in an Access database.  We are querying the data we need and
+> importing into 14 MS Excel 97 spreadsheets.  Then we are saving the
+> Excel sheets as HTML.  The HTML files bloat out with a near 100%
+> increase in file size over the original Excel files.  This is
+> because the HTML converter in Excel adds all kinds of unnecessary
+> HTML code, such as <FONT FACE="Times New Roman"> for every single
+> cell in the table.  Many of these tables have over 1000 cells, and
+> this code, along with its accompanying closing FONT tag, add up
+> quick.  The other main, unnecessary code is the ALIGN="left"
+> attribute in <TD> tags (the default alignment _is_ left).  The
+> unnecessary tags are consistent and easy to identify, and a routine
+> sh!
+> ould be writable that will automate the removal of them.
+> 
+> I created a Macro in Visual SlickEdit that automatically opens all
+> these HTML files, finds and deletes all the tags that can be
+> deleted, saves the changes and closes them.  I originally wanted to
+> do this in Python, and I would still like to know how, but time
+> constraints prevented it at the time.  Now I want to work on how to
+> create a Python program that will do this.  Can anyone help?  Has
+> anyone written anything like this in Python already that they can
+> point me too?  I would really appreciate it.
+> 
+> Again, the main flow of the program is:
+> 
+> >> Open 14 HTML files, all in the same folder and all with the .html
+> >> extension.  Find certain character strings and delete them from
+> >> the files.  In one case (the <TD> tags) it is easier to find the
+> >> whole tag with attributes and then _replace_ the original tag
+> >> with a plain <TD>.  Save the files.  Close the files.  Exit the
+> >> program.
+
+Hi Scott,
+
+I shall assume that a <TD ...> tag occurs in one line.  Try 'sed',
+    for i in *.html
+    do sed -e 's/<TD ALIGN="left">/<TD>/g" $i > /tmp/$i && mv /tmp/$i $i
+    done
+or, in Python,
+    for s in open('...', 'r').readlines():
+	s = string.replace('<TD ALIGN="left">', '<TD>', s)
+	print string.strip(s)
+	
+If <TD ...> tag spans over more than one line, then read the file in
+whole, like
+    for s in open('...', 'r').read():
+
+If the tag is not consistent, then you may have to use regular
+expression with 're' module.
+
+Hopes this helps.
+William
+
+
+> 
+> More advanced options would be the ability for the user to set
+> parameters for the program upon running it, to keep from hard-coding
+> the find and replace parms.
+
+To use command line parameters, like
+    $ cleantd 'ALIGN="left"' 
+change to
+	s = string.replace('<TD %s>' % sys.argv[1], '<TD>', s)
+
+> 
+> OK, thanks to any help you can provide.  I partly was turned on to
+> Python by Eric Raymond's article, "How to Become a Hacker" (featured
+> on /.).  I use Linux at home, but this program would be for use on a
+> Windows 95 platform at work, if that makes any difference.  I do
+> have the latest Python interpreter and editor for Windows here at
+> work.
+> 
+> Yours truly,
+> Scott
+> 
+> Scott M. Stirling
+> Visit the HOLNAM Year 2000 Web Site: http://web/y2k
+> Keane - Holnam Year 2000 Project
+> Office:  734/529-2411 ext. 2327 fax: 734/529-5066 email: sstirlin at holnam.com
+> 
+> 
+> -- 
+> http://www.python.org/mailman/listinfo/python-list
+
+
+
+

demo/ermis-f/python_m/cur/0017

@@ -0,0 +1,43 @@
+From: aa8vb at vislab.epa.gov (Randall Hopper)
+Date: Sat, 17 Apr 1999 15:23:44 GMT
+Subject: Bug with makesetup on FreeBSD
+In-Reply-To: <19990416215633.C2020@ipass.net>; from Randall Hopper on Fri, Apr 16, 1999 at 09:56:33PM -0400
+References: <19990416143607.B1546743@vislab.epa.gov> <19990416215633.C2020@ipass.net>
+Message-ID: <19990417112344.A1624668@vislab.epa.gov>
+X-UID: 17                                                 
+
+Andrew Csillag:
+|Randall Hopper wrote:
+|> Andrew Csillag:
+|>  |makesetup in Python 1.5.1 and 1.5.2 bombs on lines in the Setup file
+|>  |that use backslash continuation to break a module spec across lines on
+|>  |FreeBSD.
+|> 
+|> BTW FWIW, I just built 1.5.2 last night on 3.0-RELEASE using the 1.5.2c1
+|> port.  Worked fine.  But it may not invoke makesetup under the hood.
+|
+|It does invoke makesetup (that's how the Makefile in Modules gets
+|written).  I'm also running FreeBSD 2.2.8, so it may be a bug in /bin/sh
+|that has been subsequently fixed...  The quick test is to try this on
+|your 3.0 machine
+|
+|$ read line
+|some text here\
+|
+|On my 2.2.8 machine after I hit return after the \, I get a command line
+|prompt, not a "blank prompt" that would mean that the read wasn't done.
+
+It must be something else then, because here with stock Bourne shell:
+
+ |$ read line
+ |some text here\
+ |$ echo $line
+ |some text here\
+
+I get the same behavior you describe, but no build breakage.
+
+Randall
+
+
+
+

demo/ermis-f/python_m/cur/0018

@@ -0,0 +1,55 @@
+From: wdrake at my-dejanews.com (wdrake at my-dejanews.com)
+Date: Fri, 30 Apr 1999 18:54:25 GMT
+Subject: Oracle Call Interface
+References: <7gb3hn$lse$1@nnrp1.dejanews.com> <Pine.GSO.3.96.990430003346.3541A-100000@saga1.Stanford.EDU> <3729ADDA.8E51C1D0@palladion.com>
+Message-ID: <7gcu8v$8gp$1@nnrp1.dejanews.com>
+Content-Length: 1854
+X-UID: 18                                                  
+
+I was interested in using Oracle's Advanced Queuing (AQ), specifically the
+asynchronous event notification features.
+
+Thanks
+
+In article <3729ADDA.8E51C1D0 at palladion.com>,
+  Tres Seaver <tseaver at palladion.com> wrote:
+> Jeffrey Chang wrote:
+> >
+> > > If anyone has experience writing applications directly to the Oracle Call
+> > > Interface (OCI), in Python or JPython please send me examples or
+references on
+> > > how to do it.
+> >
+> > Yuck!  What are you planning to do?  Do you really really need to write
+> > directly to the OCI or can you use one of the available Oracle extension
+> > modules?
+> >
+> > About a year ago, I used the oracledb module from Digital Creations with
+> > Oracle7.  It's very nice, but not optimized, and thus slow for large
+> > queries.  Since then, Digital Creations has made DCOracle
+> > (http://www.digicool.com/DCOracle/; their commercial extension module)
+> > open source, so I guess that will replace oracledb.  I haven't looked at
+> > it, but according to the FAQ, it's "much faster."
+> >
+> > I strongly advise you to use an extension module or JDBC if at all
+> > possible.  Writing to the OCI is extremely ugly -- all the stuff we try to
+> > avoid by using python!
+>
+> ODBC/JDBC solutions suffer from "least-common-denominator" symptom;  one can't
+> easily exploit Oracleisms.  I haven't played with DCOracle yet, but wrapping
+OCI
+> into a nice Pythonic package would be a big win in some situations (passing
+> array parameters to stored procedures is the one I most often want).
+>
+> --
+> =========================================================
+> Tres Seaver         tseaver at palladion.com    713-523-6582
+> Palladion Software  http://www.palladion.com
+>
+
+-----------== Posted via Deja News, The Discussion Network ==----------
+http://www.dejanews.com/       Search, Read, Discuss, or Start Your Own    
+
+
+
+

demo/ermis-f/python_m/cur/0019

@@ -0,0 +1,54 @@
+From: tim_one at email.msn.com (Tim Peters)
+Date: Sun, 11 Apr 1999 02:15:54 GMT
+Subject: Python 2.0 compatibility
+In-Reply-To: <GIOP2.37825$A6.19136587@news1.teleport.com>
+References: <GIOP2.37825$A6.19136587@news1.teleport.com>
+Message-ID: <000401be83c1$3a66e060$7fa22299@tim>
+Content-Length: 1985
+X-UID: 19                                                  
+
+[Paranoid User]
+> We have selected Python as the scripting language for the next
+> generation of one of our embedded systems.
+
+Good choice!  Take the opportunity to expand it to all of your systems.
+
+> This is a very fast-track project scheduled to ship near the end of
+> the first quarter of 2000.
+
+In Internet time, that's about a century from now; but in Python time, it's
+just the early part of next year <wink>.
+
+> I ran across a quote that said something to the effect that Python 2 will
+> be incompatible with Python 1.  Before I make a decision as to whether we
+> freeze with Python 1.5.2, or migrate to Python 2 when it is released, I
+> need to find out the extent of truthfulness in the "quote".
+>
+> So, if anyone in-the-know about Python 2 could let me know the proposed
+> extent of its compatibility with 1.5.2 I would really appreciate it.
+
+If anything concrete is known about Python2, it's inside Guido's inscrutable
+head.  Don't worry about it.  Since it doesn't yet exist (nor even a wisp of
+a sketch of an outline of a design document), it's all speculation.
+
+My guess is it will end up being more compatible than most dare to hope --
+or to fear <0.7 wink>.  By and large, the only suggestions Guido has seemed
+especially keen about are considered by many to be legitimate design errors
+in Python1 (the rift between types and classes is a clear example of that;
+that e.g. 3/2 returns 1 instead of 1.5 is a controversial example).
+
+It doesn't much matter for you, though, since Python 1.6 will still be part
+of the 1.x line, and won't come out before the end of this year.  If the
+much-later-still Python2 does turn out to be wildly incompatible, there are
+enough people using the Python1 line that someone other than Guido is likely
+to take over its maintenance (even if not active future development) -- and
+*certain* to take it over if enough companies care enough to pay for that
+service.
+
+speaking-for-the-professional-prostitutes-of-the-world-ly y'rs  - tim
+
+
+
+
+
+

demo/ermis-f/python_m/cur/0020

@@ -0,0 +1,33 @@
+From: paul at prescod.net (Paul Prescod)
+Date: Thu, 29 Apr 1999 19:00:33 GMT
+Subject: padding strings
+References: <roy-2904991402400001@qwerky.med.nyu.edu>
+Message-ID: <3728AC50.9085F2C0@prescod.net>
+X-UID: 20                                                  
+
+Roy Smith wrote:
+> 
+> Given a string, I want to generate another string which is exactly N
+> characters long.  If the first string is less than N, I want to blank-pad
+> it.  If the first string is greater than N, I want to truncate it.
+> 
+> What's the most straight-forward way to do that?
+
+How about this:
+
+def mypad( s, num ):
+    return string.ljust( s, num )[:num]
+
+-- 
+ Paul Prescod  - ISOGEN Consulting Engineer speaking for only himself
+ http://itrc.uwaterloo.ca/~papresco
+
+"Microsoft spokesman Ian Hatton admits that the Linux system would have
+performed better had it been tuned."
+"Future press releases on the issue will clearly state that the research
+was sponsored by Microsoft."
+  http://www.itweb.co.za/sections/enterprise/1999/9904221410.asp
+
+
+
+

demo/ermis-f/python_m/cur/0021

@@ -0,0 +1,18 @@
+From: janssen at parc.xerox.com (Bill Janssen)
+Date: Wed, 21 Apr 1999 21:33:08 GMT
+Subject: HTTP-NG Support?
+In-Reply-To: <002201be8c08$1969e570$8b7125a6@cpda6686.mcit.com>
+References: <002201be8c08$1969e570$8b7125a6@cpda6686.mcit.com>
+Message-ID: <cr7YEI0B0KGW10rKZr@holmes.parc.xerox.com>
+X-UID: 21                                                  
+
+I've been using Python with HTTP-NG a lot, via ILU.  ILU Python
+implements the w3ng wire protocol and the w3mux protocol and most of the
+type system -- the only thing missing is local objects, and I'm working
+on them now.
+
+Bill
+
+
+
+

demo/ermis-f/python_m/cur/0022

@@ -0,0 +1,52 @@
+From: donn at u.washington.edu (Donn Cave)
+Date: 26 Apr 1999 16:40:25 GMT
+Subject: Emulating C++ coding style
+References: <371F8FB7.92CE674F@pk.highway.ne.jp> <371F9D0C.4F1205BB@pop.vet.uu.nl> <7foe7r$15mi$1@nntp6.u.washington.edu> <37245184.3AADF34D@pop.vet.uu.nl>
+Message-ID: <7g24tp$raa$1@nntp6.u.washington.edu>
+Content-Length: 1536
+X-UID: 22                                                  
+
+Martijn Faassen <faassen at pop.vet.uu.nl> writes:
+| Donn Cave wrote:
+...
+|> It's not much like C++ here, but it's uncanny how it reeks of Python!
+|> Namespaces, references!
+|
+| Indeed. Not having used that class attribute trick often myself, I
+| wasn't aware of this surprising behavior. I suppose in order to get the
+| C++ behavior it's best to use a module global variable.
+
+Not at all, either way is fine - the class scope is just as good a place
+as the module scope, for me it's the perfect place for things that are
+specific to the class.
+
+It's the usage that you have to watch out for, and while there are some
+perils for the unwary, in the long run it's also an opportunity to gain
+a deeper understanding of how simple Python is.  Same for module attributes -
+common problem, someone imports a module attribute like
+
+   from foo import shared
+   shared = 5
+
+and then wonders, how come no change to the attribute as seen from other
+modules.  The right way to set to a module attribute - if you must do this
+at all - is
+
+   foo.shared = 5
+
+and just the same for a class attribute (of class Foo):
+
+   from foo import Foo
+   Foo.shared = 5
+
+In general, you have the problem only when your usage doesn't reflect the
+design.  If it's really a class attribute, but you set it in the instance
+scope, if it's really an external module attribute but you bind it into
+the present module's scope during import.  Python bites if you trick it.
+
+	Donn Cave, University Computing Services, University of Washington
+	donn at u.washington.edu
+
+
+
+

demo/ermis-f/python_m/cur/0023

@@ -0,0 +1,31 @@
+From: xx_nospam at delorges.in-berlin.de (Jo Meder)
+Date: 16 Apr 1999 17:07:59 +0200
+Subject: HTML Authentication with Python
+References: <7f5iru$rlm@news.acns.nwu.edu> <14102.27498.772779.5941@bitdiddle.cnri.reston.va.us> <7f6577$8kp@news.acns.nwu.edu> <37171EDE.9DFD027A@quantisci.co.uk>
+Message-ID: <m3vhew1u40.fsf@delorges.in-berlin.de>
+X-UID: 23                                                  
+
+
+Stephen Crompton <scrompton at quantisci.co.uk> writes:
+
+[Excellent explanation of HTTP-Authentication snipped]
+
+If you still need to do the authentication yourself, e.g. because the
+username/password combinations are held in a database that is not
+supported by your Webserver: It can be done and how you do it depends
+on the type of server you use. I have a working solution for Apache
+(which works by (ab)using the rewrite-module) and a solution for Roxen
+Challenger that I'll test in Real Life(tm) soon.
+
+
+
+	Jo.
+
+
+-- 
+xx_nospam at delorges.in-berlin.de 
+is a valid address - ist eine gueltige Adresse.
+
+
+
+

demo/ermis-f/python_m/cur/0024

@@ -0,0 +1,33 @@
+From: fredrik at pythonware.com (Fredrik Lundh)
+Date: Tue, 13 Apr 1999 14:49:08 GMT
+Subject: CVS module
+References: <7evbjf$85f$1@anguish.transas.com>
+Message-ID: <001d01be85bc$cd9e92e0$f29b12c2@pythonware.com>
+X-UID: 24                                                  
+
+Michael Sobolev wrote:
+> My quick attempt to find something that would help me to cope with CVS files
+> failed.  Could anybody advise me whether such a module exist?  Under "such a
+> module" I mean something that permits to get the complete information about the
+> given file:
+> 
+>     cvsfile = CVSFile (<full path to file>)
+> 
+>     from pprint import pprint
+> 
+>     pprint (cvsfile.revisions)
+> 
+> or something alike.
+
+maybe
+
+    Demo/pdist/cvslib.py
+
+(in the Python source distribution) could be a start?
+
+</F>
+
+
+
+
+

demo/ermis-f/python_m/cur/0025

@@ -0,0 +1,95 @@
+From: tim_one at email.msn.com (Tim Peters)
+Date: Sat, 3 Apr 1999 06:26:17 GMT
+Subject: disenchanted java user mumbles newbie questions
+In-Reply-To: <3705980A.1C7E9512@swcp.com>
+References: <3705980A.1C7E9512@swcp.com>
+Message-ID: <000101be7d9a$e1ae88a0$879e2299@tim>
+Content-Length: 3142
+X-UID: 25                                                  
+
+[Alex Rice]
+> 1) In the Python 1.5 Tutorial, sec. 9.2 "Python Scopes and Name Spaces"
+> there is the following passage:
+
+> ...
+> -- however, the language definition is evolving towards static name
+> resolution, at ``compile'' time, so don't rely on dynamic name
+> resolution!
+> ...
+
+> Where can I read more about this move towards for compile time, static
+> name resolution and the reasons for it.
+
+Best I can suggest is scouring years' worth of DejaNews.  Most of it is
+summarized in early postings to the Python Types-SIG, though
+(http://www.python.org/, and follow the SIGS link at the top ...).
+
+"The reasons" are the same as everyone else's:  a mix of efficiency and
+compile-time-checked type safety.  I'd say the Python thrust these days may
+be more toward adding *optional* type decls, though.  OTOH, nothing has
+changed in this area of Python for > 5 years, so don't panic prematurely
+<wink>.
+
+> For some reason I was envisioning Python as being less like Java and
+> more like Objective-C or Smalltalk in terms of dynamic binding.
+
+Yes, it is.  It's extreme, though.  For example, in
+
+def sumlen(a, b, c):
+    return len(a) + len(b) + len(c)
+
+Python can't assume that "len" refers to the builtin function "len", or even
+that all three instances of "len" refer to the same thing within a single
+call (let alone across calls).  As to what "+" may mean here, it's even
+hairier.  In effect, the current semantics require that Python look up every
+non-local name and access path from scratch every time it (dynamically) hits
+one.
+
+This leads to some pretty disgusting convolutions for speeding "inner
+loops", in support of a generality that's wonderful to have but actually
+*needed* by very little code.  Because of a professional background in
+compiler optimization, I'm supposed to be appalled by this <wink>.
+
+> 2) Which reminds me: does anyone have a URL for that Ousterhut (sp?)
+> article at Sunlabs about Scripting languages and why scripting rulz and
+> where he has a taxonomy of programming languages along 2 dimensions?
+> Lost that bookmark and cannot find it again.
+
+It's one of the White Papers at:
+
+    http://www.scriptics.com/scripting/white.html
+
+
+> 3) What's the Python equivalent of depends.exe? --something to find what
+> modules your script is depending upon?
+
+Suggest searching python.org and DejaNews and Starship for "freeze" and
+"squeeze".
+
+> It seems like one would be able to create a very slim distribution if one
+> needed an .exe, couple of .dll only a handful of .py files.
+
+Why do I suspect you're a Windows programmer <wink>?  The most advanced
+Python distribution system for Win32 is likely Gordon McMillan's, available
+for free at
+
+    http://www.mcmillan-inc.com/install.html
+
+May also want to visit the Python DistUtils SIG.
+
+> A Java+Swing application can be 1-2 MB not including the VM! bloat--ed.
+
+Doubt you're going to get off much cheaper with Python + Tcl/Tk, although it
+includes two complete language implementations.
+
+> What's a typical size of a bare-bones Python distribution?
+
+Download one, unpack it, and do "dir" <wink>.
+
+soon-even-light-bulbs-will-have-20Gb-hard-drives-ly y'rs  - tim
+
+
+
+
+
+

demo/ermis-f/python_m/cur/0026

@@ -0,0 +1,26 @@
+From: boud at rempt.xs4all.nl (boud at rempt.xs4all.nl)
+Date: Sun, 25 Apr 1999 19:03:05 GMT
+Subject: GUI other than Tkinter
+References: <3721567f.1748033@news> <m2g15oygtk.fsf@desk.crynwr.com>
+Message-ID: <FArE96.5A@rempt.xs4all.nl>
+X-UID: 26                                                  
+
+Russell Nelson <nelson at crynwr.com> wrote:
+: mrfusion at bigfoot.com writes:
+: 
+:> Well, I've just about given up on EVER getting Tkinter to work on my
+:> Win98 machine.  Is there any other GUI module that I can get that
+:> doesn't require TCL/TK  to be installed on my machine?  Isn't there
+:> something called GD?  
+: 
+: There's pygtk, which uses the gtk toolkit.
+: 
+
+On Windows 98?
+-- 
+
+Boudewijn Rempt  | www.xs4all.nl/~bsarempt
+
+
+
+

demo/ermis-f/python_m/cur/0027

@@ -0,0 +1,29 @@
+From: justin at linus.mitre.org (Justin Sheehy)
+Date: 23 Apr 1999 22:09:54 -0400
+Subject: Python too slow for real world
+References: <372068E6.16A4A90@icrf.icnet.uk> <3720A21B.9C62DDB9@icrf.icnet.uk> <3720C4DB.7FCF2AE@appliedbiometrics.com> <3720C6EE.33CA6494@appliedbiometrics.com> <y0jaevznhha.fsf@vier.idi.ntnu.no>
+Message-ID: <glmvhemn4zx.fsf@caffeine.mitre.org>
+X-UID: 27                                                  
+
+mlh at idt.ntnu.no (Magnus L. Hetland) writes:
+
+> (And... How about builtin regexes in P2?)
+
+Um, why?  I don't see any need at all for them to move from
+module-status to core-language-status.  
+
+The only way that I could understand the desire for it would be if one 
+wanted to write little scripts that were basically just some control
+flow around regexes and string substitution.  That is, something that
+looked like most of the programs written in that other P language.  ;-)
+
+In all seriousness, what reason do you have for making that
+suggestion?  I am willing to believe that there might be a good reason 
+to do so, but it certainly isn't immediately obvious.
+
+-Justin
+
+
+
+
+

demo/ermis-f/python_m/cur/0028

@@ -0,0 +1,39 @@
+From: tim_one at email.msn.com (Tim Peters)
+Date: Thu, 8 Apr 1999 06:26:21 GMT
+Subject: Crappy Software was Re: [OffTopic: Netscape] Re: How should 
+In-Reply-To: <1288614834-78399188@hypernet.com>
+References: <1288614834-78399188@hypernet.com>
+Message-ID: <000a01be8188$b7f56280$749e2299@tim>
+Content-Length: 1037
+X-UID: 28                                                  
+
+[Gordon McMillan, among others with Netscape vs IE experience]
+> ...
+> Having recently ported a sophisticated applet using JNI (Sun's new
+> native interface) to JRI (older Netscape) and RNI (older IE), I too
+> can kick and scream.
+> [guess the outcome <wink>]
+
+I'm no browser wizard -- just took a few stabs over the past year & a half
+at writing some relatively simple Java applets, JavaScript and HTML for the
+amusement of my family.  No CSS, no frames, nothing at all even remotely
+cutting-edge.  One Netscape-using sister had dozens of problems with *all*
+of these, most eventually determined to be cases of NS not meeting the
+appropriate std, and-- far too often --crashing her machine.
+
+Fact is NS dropped the browser ball a couple years ago, then poked holes in
+it, then attached industrial-strength vacuum cleaners on the off chance any
+air remained.
+
+> ...
+> When's the last time you closed a GUI from the file menu??
+
+Hey, I'll close a stinking GUI any way I can <wink>.
+
+right-next-to-my-reboot-foot-pedal-ly y'rs  - tim
+
+
+
+
+
+

demo/ermis-f/python_m/cur/0029

@@ -0,0 +1,50 @@
+From: mwh21 at cam.ac.uk (Michael Hudson)
+Date: 18 Apr 1999 01:09:48 +0100
+Subject: Plugins, or selecting modules to import at runtime
+References: <924379180.825429211@news.intergate.bc.ca> <924385178.948235039@news.intergate.bc.ca>
+Message-ID: <m34smeyek3.fsf@atrus.jesus.cam.ac.uk>
+Content-Length: 1063
+X-UID: 29                                                  
+
+Gerald Gutierrez <gutier at intergate.bc.ca> writes:
+> Never mind. I just found the module "imp".
+
+That's waay overkill for what you need; the builtin function
+__import__ will do nicely:
+
+Python 1.5.2 (#2, Apr 14 1999, 13:02:03)  \
+  [GCC egcs-2.91.66 19990314 (egcs-1.1.2  on linux2
+Copyright 1991-1995 Stichting Mathematisch Centrum, Amsterdam
+>>> __import__("sys")
+<module 'sys' (built-in)>
+>>> s=__import__("sys")
+>>> s
+<module 'sys' (built-in)>
+>>> 
+
+HTH
+
+Michael
+
+> Thanks.
+> 
+> On Sat, 17 Apr 1999, Gerald Gutierrez wrote:
+> >Hi all.
+> >
+> >I'd like to write a program in Python in which the user can select one of
+> >several modules to execute through a function that has the same name in all the
+> >modules. I don't believe "import" lets me pass it a string. There is also
+> >reload(), but the module to reload must be previously imported.
+> >
+> >This is very similar to plugins like that used in Netscape, Photoshop and the
+> >GIMP.
+> >
+> >Can someone please give me a hint?
+> >
+> >Thanks.
+> >
+> >Please forward replies to gutier at intergate.bc.ca.
+
+
+
+

demo/ermis-f/python_m/cur/0030

@@ -0,0 +1,45 @@
+From: tavares at connix.com (Chris Tavares)
+Date: Sat, 10 Apr 1999 12:14:26 -0400
+Subject: pythonwin COM Update link out of date
+References: <slrn7gt244.3s6.bernhard@alpha1.csd.uwm.edu> <7em639$fto$1@m2.c2.telstra-mm.net.au>
+Message-ID: <370F78E2.8EA7433E@connix.com>
+Content-Length: 1039
+X-UID: 30                                                  
+
+Mark Hammond wrote:
+
+> Bernhard Reiter wrote in message ...
+> >http://www.python.org/ftp/python/pythonwin/pwindex.html#oadist
+> >
+> >Gives a bad link to the MS  Microsoft Knowledge Base article Q164529.
+> >The link is bad and I cannot relocate the article with the search
+> >engine on that site and other methods... :(
+> >
+> >The closest I could get was:
+> > http://support.microsoft.com/support/kb/articles/Q139/4/32.asp
+> >from
+> > http://support.microsoft.com/support/downloads/LNP195.asp
+> >
+> >Hmmmm.... is there a potential danger in installing oadist.exe?
+>
+> There _shouldnt_ be any danger!
+>
+> These days it is getting quite unnecessary.  If you have (I believe) IE4 or
+> Office 97, you are pretty up-to-date, and that includes many PCs these days.
+>
+> You could try installing the Python stuff, and see if it works.  Also, see
+> my other post this morning as to why the install may fail - try this out
+> first.
+>
+> Mark.
+
+Another option is to download DCOM for Win95 - that'll get the user up to date
+and then some!
+
+-Chris
+
+
+
+
+
+

demo/ermis-f/python_m/cur/0031

@@ -0,0 +1,52 @@
+From: bernhard at alpha1.csd.uwm.edu (Bernhard Reiter)
+Date: 18 Apr 1999 04:31:27 GMT
+Subject: NT: win32api and win32ui import error
+References: <7fbcpq$2jb$1@nnrp1.dejanews.com>
+Message-ID: <slrn7hio0v.vlp.bernhard@alpha1.csd.uwm.edu>
+Content-Length: 1230
+X-UID: 31                                                  
+
+On Sun, 18 Apr 1999 01:33:46 GMT, hj_ka at my-dejanews.com <hj_ka at my-dejanews.com> wrote:
+>I don't know whether this is also related: when I installed
+>win32all-124.exe, I got a few warnings:
+>
+>"Registration of the (AXScript/Python Interpreter/Python Dictionary)
+>failed. Installation will continue, but this server will require
+>manual registration before it will function."
+
+I had the same warnung and also cannot run the win32 extentions.
+(import win32com.client e.g. fails for me.)
+
+Mark Hammond suggested to update some DLLs and it might
+very well be a problem related to old DLL version.
+(I didn't manage for some reasons to update my DLLs here on my 
+Windows95 system, so I finally gave up. Any Windows Hacker with
+experience in this speak up and offer help! ;-) )
+
+ Mark said, that the following dll and their versions might
+be relevant:
+
+ole32.dll      
+oleaut32.dll
+msvcrt.dll 
+
+The following are used, but should be fine:
+pywintypes15.dll 
+python15.dll
+kernel32.dll
+user32.dll 
+
+You can check the version number in the explorer im C:windows/system 
+with properties.
+
+Maybe an upgrade package including these .DLLs from support.microsoft.com 
+can help.
+
+
+Please report back, If you found a solution...
+
+	Bernhard
+
+
+
+

demo/ermis-f/python_m/cur/0032

@@ -0,0 +1,51 @@
+From: bill_seitz at my-dejanews.com (bill_seitz at my-dejanews.com)
+Date: Thu, 15 Apr 1999 15:02:28 GMT
+Subject: stupid Win-CGI getting started question
+References: <7f0f0h$pfb$1@nnrp1.dejanews.com> <8DA86302Bduncanrcpcouk@news.rmplc.co.uk> <7f2no0$n80$1@nnrp1.dejanews.com> <8DA9637FEduncanrcpcouk@news.rmplc.co.uk>
+Message-ID: <7f4v1u$jpd$1@nnrp1.dejanews.com>
+Content-Length: 2001
+X-UID: 32                                                  
+
+In article <8DA9637FEduncanrcpcouk at news.rmplc.co.uk>,
+  Duncan Booth <duncan at rcp.co.uk> wrote:
+
+> I didn't say it was impossible to run .py files as CGI, simply that I had
+> problems getting it to work. Since my number one priority was not to take
+> the web server off-line at all, there were limits to how far I could play
+> around with it. I'm sure there must be some way to get it to work, but I
+> got enough for my purposes.
+
+Gotcha.
+
+I did some more playing around. No success, but here's what I did/found: When
+I try to call a .py file I get the "This server has encountered an internal
+error which prevents it from fulfilling your request" message. The NES error
+log shows: [15/Apr/1999:10:35:53] failure: for host 192.246.193.43 trying to
+GET /pcgi/dntest.py, send-cgi reports: could not send new process (File Not
+Found Error) [15/Apr/1999:10:35:53] failure: cgi_send:cgi_start_exec
+d:\program files\python\lib\dntest.py failed
+
+If I rename the .py file to .cmd and call it with that name, it works fine.
+
+I'm defining a /pcgi/ path to point to the location of the python files, so
+I'm not counting on the suffix to mean anything. All the various CGI folders
+get mapped to object name="cgi", but again, since suffix is irrelevant, that
+shouldn't be the problem.
+
+I went into mime.types and added the py extension to the cgi reference (note
+that cmd is not in that extension list). Still get an error, but the log
+changes to [15/Apr/1999:10:52:57] failure: for host 192.246.193.43 trying to
+GET /pcgi/dntest.py, send-cgi reports: could not send new process (Error
+Number is unknown) [15/Apr/1999:10:52:57] failure: cgi_send:cgi_start_exec
+d:\program files\python\lib\dntest.py failed
+
+Does this suggest any clues? I've asked a friend who doesn't know Python but
+knows Netscape pretty well. Will report back if he has any suggestions.
+
+
+-----------== Posted via Deja News, The Discussion Network ==----------
+http://www.dejanews.com/       Search, Read, Discuss, or Start Your Own    
+
+
+
+

demo/ermis-f/python_m/cur/0033

@@ -0,0 +1,30 @@
+From: garryh at att.com (Garry Hodgson)
+Date: Fri, 9 Apr 1999 17:37:27 GMT
+Subject: Is Python dying?
+References: <7dos4m$usi$1@nnrp1.dejanews.com> <7e30fp$8vf$1@news1.rmi.net> <14085.18282.936883.727575@bitdiddle.cnri.reston.va.us> <7ectjd$516$1@srv38s4u.cas.org> <e5XO2.32678$FZ5.12416@news.rdc1.sfba.home.com> <19990408075544.B983383@vislab.epa.gov>
+Message-ID: <370E3AD7.16C48C5F@att.com>
+X-UID: 33                                                  
+
+Randall Hopper wrote:
+
+> I believe that was Fredrik Lundh <fredrik at pythonware.com>.
+> 
+> In shopping for Python books late last month, I happened upon his announced
+> plan to write a Tkinter book.  So I slipped him an e-mail query asking how
+> the book was going and if he had an estimated timeframe (in case it was
+> close to market), but I haven't received a response.  I assume he's just
+> busy like the rest of us.
+
+for what it's worth, fredrik has never replied to any of the mail i've
+sent him.
+your mileage may vary.
+
+-- 
+Garry Hodgson			seven times down
+garry at sage.att.com		eight times up
+Software Innovation Services	
+AT&T Labs			- zen proverb
+
+
+
+

demo/ermis-f/python_m/cur/0034

@@ -0,0 +1,35 @@
+From: fdrake at cnri.reston.va.us (Fred L. Drake)
+Date: Tue, 20 Apr 1999 13:18:38 GMT
+Subject: Can't work this XDR out
+In-Reply-To: <371C0CF7.2D1260D7@hons.cs.usyd.edu.au>
+References: <371C0CF7.2D1260D7@hons.cs.usyd.edu.au>
+Message-ID: <14108.32430.842541.785124@weyr.cnri.reston.va.us>
+X-UID: 34                                                  
+
+Matthew Robert Gallagher writes:
+ > Whilst trying to pack a list xdr packer asks for
+ > 
+ > (list, pack_item)
+ > 
+ > what is the pack_item can't work this out as there are no examples
+
+Matthew,
+  pack_item will typically be another method from the same packer
+object.  For example, to pack a list of ints, use this:
+
+	import xdrlib
+	p = xdrlib.Packer()
+	p.pack_list([1, 2, 3], p.pack_int)
+
+  I hope this helps.  I'll add an example to the documentation.
+
+
+  -Fred
+
+--
+Fred L. Drake, Jr.	     <fdrake at acm.org>
+Corporation for National Research Initiatives
+
+
+
+

demo/ermis-f/python_m/cur/0035

@@ -0,0 +1,35 @@
+From: holger at phoenix-edv.netzservice.de (Holger Jannsen)
+Date: Thu, 22 Apr 1999 13:48:58 GMT
+Subject: sort of multiple dictonaries
+Message-ID: <371F28CA.2240BB7B@phoenix-edv.netzservice.de>
+X-UID: 35                                                  
+
+Hi there,
+
+perhaps a typical newbie-question:
+
+I've got a list of dictonaries like that:
+
+mydics=[{'sortit': 'no412', 'mode': 'nothing'},
+{'sortit': 'no112', 'mode': 'something'},
+{'sortit': 'no02', 'mode': 'something else'}]
+
+Is there an easy way to get that list sorted like that:
+
+def sortDictonary(aDictonary, theSortKey="sortit"):
+	....
+
+Result have to be:
+
+mydics=[{'sortit': 'no02', 'mode': 'something else'},
+{'sortit': 'no112', 'mode': 'something'},
+{'sortit': 'no412', 'mode': 'nothing'}]
+
+Any hints?
+
+Ciao,
+Holger
+
+
+
+

demo/ermis-f/python_m/cur/0036

@@ -0,0 +1,38 @@
+From: justin at linus.mitre.org (Justin Sheehy)
+Date: 29 Apr 1999 11:45:50 -0400
+Subject: Designing Large Systems with Python
+References: <m37lqz0yoa.fsf@solo.david-steuber.com> <372599D6.C156C996@pop.vet.uu.nl> <7g4a3l$atk$1@news.worldonline.nl> <m3vhehxjhr.fsf@solo.david-steuber.com>
+Message-ID: <glm1zh3h1ld.fsf@caffeine.mitre.org>
+X-UID: 36                                                  
+
+David Steuber <trashcan at david-steuber.com> writes:
+
+> I would like better python support in XEmacs.  There is a python
+> mode, but I haven't seen anything about evaluating Python code
+> ineteractivly the way you can with Lisp and elisp.
+
+The support for Python in XEmacs will obviously never be as good as
+the support for emacs lisp.  However, it is already about as good as
+it is for other lispy things like clisp, scheme, etc.
+
+One can run a python interpreter in an emacs window.  This can be
+interacted with directly, or you can send code to it from a
+python-mode buffer.  It has served my needs fairly well.
+
+> -> ehh, Python?
+> 
+> It looks interesting.  It is more C like than Lisp like. 
+
+Well, in the obvious syntactical sense, sure.
+
+I am comfortable in several dialects of Lisp, but find C to be No Fun.
+I am rapidly becoming at home with Python.  In many of the
+less-immediately-obvious but very important ways, I find that Python
+doesn't feel much like C at all.
+
+-Justin
+
+
+
+
+

demo/ermis-f/python_m/cur/0037

@@ -0,0 +1,26 @@
+From: ruebe at aachen.heimat.de (Christian Scholz)
+Date: Mon, 26 Apr 1999 20:12:12 +0000
+Subject: tzname problem
+Message-ID: <3724C89C.256703D0@aachen.heimat.de>
+X-UID: 37                                                  
+
+Hi!
+
+I compiled and installed Python 1.5.2 on my Linux box.
+But I have a problem when using tzname (well, actually Zope has):
+
+>>> from time import tzname
+Traceback (innermost last):
+  File "<stdin>", line 1, in ?
+ImportError: cannot import name tzname
+>>> 
+
+Does anybody know why this happens? timemodule is included
+of course..
+
+best,
+  Christian
+
+
+
+

demo/ermis-f/python_m/cur/0038

@@ -0,0 +1,127 @@
+From: gjohnson at showmaster.com (Tony Johnson)
+Date: Fri, 23 Apr 1999 16:03:57 GMT
+Subject: Python too slow for real world
+In-Reply-To: <372068E6.16A4A90@icrf.icnet.uk>
+References: <372068E6.16A4A90@icrf.icnet.uk>
+Message-ID: <000401be8da2$e5172430$7153cccf@showmaster.com>
+Content-Length: 3295
+X-UID: 38                                                  
+
+I find python syntax less taxing then perl's (IE less lines)  You may need
+to check your python code and see how you can optimize it further...
+
+Tony Johnson
+System Administrator
+Demand Publishing Inc.
+
+
+-----Original Message-----
+From: python-list-request at cwi.nl [mailto:python-list-request at cwi.nl]On
+Behalf Of Arne Mueller
+Sent: Friday, April 23, 1999 7:35 AM
+To: python-list at cwi.nl
+Subject: Python too slow for real world
+
+
+Hi All,
+
+first off all: Sorry for that slightly provoking subject ;-) ...
+
+I just switched from perl to python because I think python makes live
+easyer in bigger software projects. However I found out that perl is
+more then 10 times faster then python in solving the following probelm:
+
+I've got a file (130 MB) with ~ 300000 datasets of the form:
+
+>px0034 hypothetical protein or whatever description
+LSADQISTVQASFDKVKGDPVGILYAVFKADPSIMAKFTQFAGKDLESIKGTAPFETHAN
+RIVGFFSKIIGELPNIEADVNTFVASHKPRGVTHDQLNNFRAGFVSYMKAHTDFAGAEAA
+WGATLDTFFGMIFSKM
+
+The word floowing the '>' is an identifier, the uppercase letters in the
+lines following the identifier are the data. Now I want to read and
+write the contens of that file excluding some entries (given by a
+dictionary with identifiers, e.g. 'px0034').
+
+The following python code does the job:
+
+from re import *
+from sys import *
+
+def read_write(i, o, exclude):
+    name = compile('^>(\S+)') # regex to fetch the identifier
+    l = i.readline()
+    while l:
+        if l[0] == '>': # are we in new dataset?
+            m = name.search(l)
+            if m and exclude.has_key(m.group(1)): # excluding current
+dataset?
+                l = i.readline()
+                while l and l[0] != '>':  # skip this dataset
+                    l = i.readline()
+                    pass
+        o.write(l)
+        l = i.readline()
+
+f = open('my_very_big_data_file','r') # datafile with ~300000 records
+read_write(f, stdout, {}) # for a simple test I don't exclude anything!
+
+It took 503.90 sec on a SGI Power Challange (R10000 CPU). An appropiate
+perl script does the same job in 32 sec (Same method, same loop
+structure)!
+
+Since I've to call this routine about 1500 times it's a very big
+difference in time and not realy accaptable.
+
+I'd realy like to know why python is so slow (or perl is so fast?) and
+what I can do to improove speed of that routine.
+
+I don't want to switch back to perl - but honestly, is python the right
+language to process souch huge amount of data?
+
+If you want to generate a test set you could use the following lines to
+print 10000 datasets to stdout:
+
+for i in xrange(1, 10001):
+    print
+'>px%05d\nLSADQISTVQASFDKVKGDPVGILYAVFKADPSIMAKFTQFAGKDLESIKGTAPFETHAN\n\
+RIVGFFSKIIGELPNIEADVNTFVASHKPRGVTHDQLNNFRAGFVSYMKAHTDFAGAEAA\n\
+WGATLDTFFGMIFSKM\n' % i
+
+And if you don't believe me that perl does the job quicker you can try
+the perl code below:
+
+#!/usr/local/bin/perl -w
+open(IN,"test.dat");
+my %ex = ();
+read_write(%ex);
+
+sub read_write{
+
+  $l = <IN>;
+ OUTER: while( defined $l ){
+    if( (($x) = $l =~ /^>(\S+)/) ){
+      if( exists $ex{$x} ){
+	$l = <IN>;
+	while( defined $l && !($l =~ /^>(\S+)/) ){
+	  $l = <IN>;
+	}
+	next OUTER;
+      }
+    }
+    print $l;
+    $l = <IN>;
+  }
+}
+